54,054 Free Images of Us Navy

vehiclemilitaryshipaircraftarmyjetboatwaterseaaviation
US Navy 120121-N-FI736-205 The Oliver Hazard Perry-class frigate USS Samuel B. Roberts (FFG 58) and the Ticonderoga-class guided-missile cruiser US
boatsea
US Navy 100514-N-6357K-042 Seabees assigned to Naval Mobile Construction Battalion (NMCB) 7 use a screed board to smooth and remove excess concrete at a sidewalk project at Naval Station Rota
militaryarmy
US Navy 080922-N-2183K-097 A plane captain of an AV-8B Harrier jet guides the aircraft as it is towed on the flight deck
aircraftvehicle
US Navy 080828-N-3560G-106 Construction Electrician 2nd Class Joseph Ulep, assigned to Naval Mobile Construction Battalion (NMCB) 4, extinguishes a class
naval mobile construction battalion 4camp lemonnier
US Navy 100909-N-8113T-187 Machinist's Mate 3rd Class Cuong Do, left, uses a Naval firefighting thermal imager (NFTI) to find hotspots
aboard uss denver (lpd-9)people
US Navy 071204-N-3925A-001 Seaman Derrick Bryant uses a telescopic alidade to take relative bearing measurements aboard the amphibious transport dock USS Cleveland (LPD 7)
relative bearingalidade
US Navy 110329-N-OM503-037 Machinist's Mate 1st Class Nicholas Gerloff uses a Radiac meter on Rear Adm. Jeffery
aboard uss frank cable (as-40)2011
US Navy 120209-N-RG587-154 Hull Maintenance Technician Fireman Adam Garcia uses a tig welder to join two pieces of steel in the metalsmithing shop
aboard uss carl vinson (cvn-70)dark
US Navy 060821-N-3714J-069 Navy Musician 2nd Class Kerry Mahaffey, a member of the U.S. Navy Showband embarked with the Medical Treatment Facility aboard the Military Sealift Command hospital ship USNS Mercy (T-AH 19), plays th
celebritiesgroup
US Navy 090806-N-6220J-004 Sailors and Navy Delayed Entry Program members serve breakfast to homeless men and women at Dorothy's Soup Kitchen in Salinas, Calif. during Salinas Navy Week community service event
food bankyellow
US Navy 110713-N-IL276-002 Navy officials unveil an exhibit during the Department of the Navy tribute to African-American leadership
united states navy images from the pentagonray mabus in 2011
US Navy 090701-N-6814F-221 Senior Chief Navy Diver Craig Simon debriefs Navy Diver 2nd Class Greg Early after completing a dive around the hull of mine countermeasure ship USS Scout (MCM 8) at Umm Qasr, Iraq
united states navy images from umm qasrunited states navy divers
US Navy 061019-N-7405P-001 Aviation Boatswain's Mate (Handler) Airman David Rivera uses a low-pressure air hose to clean padeyes on the flight deck aboard USS Harry S. Truman (CVN 75)
virginiahandler
US Navy 091116-N-6692A-034 Marines from the 31st Marine Expeditionary Unit (31st MEU) fast-rope from a CH-46 Sea Knight helicopter during visit, board, search and seizure training exercise
militaryaircraft
US Navy 090717-N-9520G-078 An AV-8B Harrier lands aboard the amphibious assault ship USS Essex (LHD 2) during a Talisman Saber 2009 exercise
militaryvehicle
US Navy 070705-N-0194K-125 Ambassador William Eaton, U.S. ambassador to Panama, a child and his father with t-shirts as Camilo Alleyne, minister of health for Panama looks on aboard the Military Sealift Command hospital ship US
panamagroup
US Navy 080619-N-0483B-009 Aviation Boatswain's Mate 3rd Class Mark R. Joseph signals to an AV-8B Harrier assigned to
militaryaircraft
US Navy 080212-N-8335D-184 Capt. Vincent K. Dixon, left, and 1st Lt. Andrew C. Robbins of Marine Medium Helicopter Squadron Reinforced (HMM (REIN)) 166 land their AH-1W Super Cobra on the amphibious assault ship USS Tarawa (LHA
ah-1w supercobra (us marine corps)navy
US Navy 100528-N-3136P-179 An Italian navy visit, board, search and seizure team member collects evidence using a wireless device aboard the Military Sealift Command container and roll-on-roll-off ship USNS LCPL Roy M. Wheat (T
phoenix express 2010evidence collection
US Navy 110606-N-DR144-350 An F-A-18E Super Hornet assigned to Strike Fighter Squadron (VFA) 81 maneuvers over the Nimitz-class aircraft carrier US
militaryvehicle
US Navy 111212-A-TF780-101 Sgt. Mark Miller observes Salvadoran Marines as they use a lensatic compass to help them complete a land navigation cour
el salvadororiental
US Navy 120115-N-OY799-337 An F-A-18F Super Hornet from the Black Aces of Strike Fighter Squadron (VFA) 41 launches off the flight deck of the Nimi
lightnight
US Navy 030426-N-6141B-017 The guided missile destroyer USS Mitscher (DDG 57) passes a memorial built in recognition of the defense of the Suez Canal from 1914-1918 while transiting the Suez Canal
boatsea
US Navy 030826-N-4374S-015 A rescue swimmer assigned to the Chargers of Helicopter Combat Support Squadron SIX (HC-6) hovers over a Rigid Hull Inflatable Boat (RHIB) during recovery operations
militaryarmy
US Navy 081021-N-5681S-023 An AV-8B Harrier lands on the flight deck of on the multi-purpose amphibious assault ship USS Iwo Jima (LHD 7)
militaryvehicle
US Navy 080923-N-9134V-161 The guided-missile destroyer USS Ramage (DDG 61) and the multi-purpose amphibious assault ship USS Iwo Jima (LHD 7) transit the Suez Canal
vehiclewater
US Navy 100718-N-1082Z-016 The guided-missile cruiser USS San Jacinto (CG 56) transits the Suez Canal followed by the amphibious transport dock ship USS Mesa Verde (LPD 19)
vehiclecold
US Navy 080910-N-4649C-001 Sailors assigned to the ballistic-missile submarine USS Henry M. Jackson (SSBN 730) participate in firefighting training at the advanced firefighting school at Trident Training Facility, Bangor
sailors from the united states navysuspenders
US Navy 100312-N-7948C-033 Italian navy Lt. Cmdr. Marco Compasso, assigned to Africa Partnership Station (APS) West staff, speaks with a Ghanaian Sailor during a maritime domain awareness workshop aboard the amphibious dock lan
united states navy in sekondi-takoradiaboard uss gunston hall (lsd-44)
US Navy 100523-N-0413B-201 Navy Diver 2nd Class James Maxey, left, and Navy Diver 2nd Class Dicky Ellis, both assigned to Mobile Diving Salvage Unit (MDSU) 1, conduct post dive maintenance on a MK-3 diving helmet
joint pow/mia accounting commandunited states navy divers
US Navy 110922-N-RI844-133 A Bangladesh navy sailor fires a Type-56 assault rifle aboard the Bangladesh navy frigate BNS Bangabandhu (F 25) during
military2001
US Navy 100810-N-9818V-019 The U.S. Navy Ceremonial Guard presents the colors at the Armed Forces Retirement Home during a dedication ceremony for an anchor
washingtonarmy
Cruising surface sea
watersea
New Providence NJ Historical military vehicle US Navy
self-published workcc-zero
Lt. j.g. John Thompson, right, and Vytautas Grubliauskas, mayor of Klaipeda, Lithuania, play improvised jazz. (19300406804)
us navy picture of the daypoliticians of lithuania
Rear Adm. J.R. Haley ons his flight suit before flying in an MH-53E Sea Dragon helicopter. (16733674425)
us navy picture of the day
President George H. W. Bush is greeted at NAS Miramar by US Navy Rear Admiral Paul W. Parcells
george h. w. bush in 1992
Ships and aircraft search for a missing Malaysian Airlines jet. (13132494885)
boatsea
Command Master Chief Josh Dugan renders a salute for a formation of chief petty officers. (16835051888)
naval station everettarmy
151025-N-AX638-029 (22496242241)
militaryvehicle
US Navy 101014-N-9564W-023 Hospital Corpsman hard-wire a generator during a battalion field training exercise
hospital corpsmencamp shelby
US Navy 111215-N-KA046-100 Sailors fight a mock fire during a general quarters drill
aboard uss bataan (lhd-5)people
US Navy 090226-N-6538W-120 Sailors provide simulated medical treatment to a mock personnel casualty
aboard uss antietam (cg-54)red
USS Mitscher conducts approach, assist and visit operations. (15536908763)
vehiclefish
US Navy 111008-N-ZC343-229 Sailors take down the national ensign during evening colors
aboard uss bonhomme richard (lhd-6)
US Navy 110409-N-DD445-003 Participants in the 2011 Soldier Ride peddle through Jacksonville to support the Wounded Warrior Project
military in jacksonvilleflorida
US Navy 080110-N-2984R-053 Aviation Maintenance Administrationman Airman Ashley Connors, assigned to the
aboard uss harry s. truman (cvn-75)
US Navy 100527-N-7705S-032 Members of the Submarine Learning Facility color guard and submarine veterans parade the colors
naval station norfolkarmy
US Navy 110715-N-KB052-430 Gas Turbine Systems Technician (Mechanical) 2nd Class Trinadee Jone
aboard uss cowpens (cg-63)
US Navy 110729-N-FG395-040 USS Tennessee (SSBN 734) is pierside at Naval Submarine Base Kings Bay
uss tennessee (ssbn-734)
US Navy 110520-N-GS507-784 Staff and students at the Center for Information Dominance (CID) Corry Station participate in morning colors during the
pensacolaflorida
US Navy 110818-N-ZS026-382 The Boxer Amphibious Ready Group transits the Indian Ocean
general views of uss boxer (lhd-4)night
US Navy 111215-N-KA046-055 A Sailor discovers a mock casualty during a general quarters drill
aboard uss bataan (lhd-5)light
US Navy 111214-N-GO535-026 A Sailor distribute Christmas presents to homebound and elderly people
naval air station fort worthmeals on wheels
US Navy 111215-N-DI719-010 A CO speaks during the Granger Junior High School Career Fair
aboard uss curts (ffg-38)
US Navy 111221-N-DI599-027 Sailors aboard USS North Carolina receive a line
watership
US Navy 111226-N-TZ605-041 A Sailor rinses a jet on the flight deck
aircraftvehicle
US Navy 100122-N-7317W-003 USNS Laramie conducts underway replenishments with ships underway
general views of usns laramie (t-ao-203)
US Navy 120112-N-ZI635-110 Sailors perform maintenance on the tire of an F-A-18 C Hornet
aboard uss carl vinson (cvn-70)
US Navy 111101-N-XQ375-511 Sailors attach a cargo net to an MH-60R Sea Hawk helicopter
aboard uss mitscher (ddg-57)
US Navy 111101-N-DU438-194 Sailors enter the pilothouse to investigate the space during a fire drill
aboard uss gettysburg (cg-64)people
US Navy 120207-N-OY799-117 An EA-6B Prowler from the
aircraftvehicle
US Navy 120207-N-FI736-191 Sailors take part in a burial at sea ceremony
aboard uss enterprise (cvn-65)bold alligator 2012
US Navy 120207-N-YZ751-019 A Sailor trains on arresting gear equipment
aboard uss george h. w. bush (cvn-77)people
US Navy 120104-N-PB383-434 A Marine relays a message to releases cargo onto the flight deck
aboard uss pearl harbor (lsd-52)
US Navy 111020-N-BT887-105 Logistics specialists unwrap cargo during a vertical replenishment
aboard uss john c. stennis (cvn-74)
US Navy 100731-N-3090M-474 USS Missouri (SSN 780) salutes the spectators during its commissioning
commissioning of uss missouri (ssn-780)
US Navy 010912-N-3235P-016 debris embedded in a tree near Pentagon crash site
aircraft accident debris2001
US Navy 080903-N-4154B-021 Jim Schermerhorn takes a moment to cool off
effects of hurricane gustav in baton rougehospitals in baton rouge
US Navy 030329-N-4048T-052 Sailors from Deck Department take part in a Deck Seamanship Olympics
aboard uss kearsarge (lhd-3)
US Navy 081114-N-7367K-031 Seabees work together to launch a medium girder bridge
militaryarmy
US Navy 081204-N-2456S-099 Aviation Maintenance Administration 2nd Class Tianna Simmons, assigned to the
aboard uss theodore roosevelt (cvn-71)
US Navy 030318-N-0000X-003 The book cover of Farragut, America's First Admiral
naval history and heritage commandbook cover
US Navy 080723-N-5148B-003 Cpl. Mathew Roberts gives a helicopter a fresh-water wash down
aboard uss peleliu (lha-5)
US Navy 020626-N-4374S-013 Sailors conduct a foreign object debris (FOD) walkdown
aboard uss cushing (dd-985)fod walkdown
US Navy 021107-N-1810F-004 proper techniques on approaching an aircraft fire or a hazardous situation
flight deck of uss kitty hawk (cv-63)
US Navy 030113-N-1671M-001 logo for a Shared Reconnaissance Pod (SHARP)
shared reconnaissance pod (sharp)aboard uss nimitz (cvn-68)
US Navy 031020-O-0000X-001 Period engraving of the frigate USS Sabine
vehiclewater
US Navy 080902-N-1522S-008 Aviation Ordnanceman Airman Jerome Mckenzie inspects a helicopter drive shaft
aviation ordnancemanflorida
US Navy 080902-N-1688B-250 Aviation boatswain's mates practice extinguishing a
aviation boatswain's matejet
US Navy 080930-N-1120L-012 Seabees board an Air Force C-17
lightnight
US Navy 081114-N-7367K-028 Seabees work together to launch a medium girder bridge
panoramawood
US Navy 081121-N-8467N-001 Naval Submarine School Silver Dolphins parade the colors
people at naval submarine base new londoncelebrities
US Navy 081211-N-9584N-110 Seabees lie in the prone position ready to provide reinforcement during field training exercise
fort hunter liggett
US Navy 100906-N-4044H-153 Sailors conduct humanitarian mission in Papua New Guinea
sportgame
US Navy 100129-N-7939W-048 USNS Richard E. Byrd conducts underway replenishment
aboard uss nimitz (cvn-68)n10248 (aircraft)
US Navy 100507-N-9301W-242 A Uruguayan naval officer assists with the navigation of USS Klakring (FFG 42)
aboard uss klakring (ffg-42)
Students work on an outboard motor. (21258483309)
naval small craft instruction and technical training school since 1st october 1998us navy picture of the day
US Navy 100403-N-6138K-792 Capt. Cindy Thebaud, commander of Africa Partnership Station West, tours the Armed Forces of Liberia Coast Guard Base in Monrovia with U.S. Navy Lt. Aaron Allison from Austin, Texas, and Chief Builder
builder (united states navy)army
US Navy 091029-N-6220J-006 Lt. j.g. Meg Ferguson teaches a young girl the proper way to salute during a U.S. Navy community service event at the Finnigan Park Boys and Girls Club
boys & girls clubs of americagirls of the united states
US Navy 091107-N-8689C-074 A Navy SEAL points to members of the crowd during a capabilities demonstration as part of the 2009 Veteran's Day Ceremony and Muster XXIV at the National Navy UDT-SEAL Museum in Fort Pierce, Fla
males with m4 carbinemolle armor carriers
US Navy 071120-N-8933S-006 Rear Adm. Tony Kurta, director for Policy, Resources and Strategy, U.S. Naval Forces Europe, and Ghanaian navy Commodore Matthew Quashie, Eastern Ghana Naval Command, meet with Africa Partnership Stat
naval officers of ghanaanthony m. kurta
POINT LOMA, Calif. (April 12, 2007) - Marine mammal handlers give a demonstration of the Navy Marine Mammal Program. The Navy uses sea lions to mark and retrieve objects and to locate mines. U.S Navy
animalsvehicle
US Navy 020720-N-6492H-610 USS Kennedy Sailors man the rails as they pull into Marmaris, Turkey
vehicleboat
US Navy 030212-N-1050K-001 Lt. Gen. Fahad Al-Amir, Kuwaiti Armed Forces Chief of Staff, during his recent visit to KNB
militaryarmy
US Navy 030329-N-6141B-003 The Spruance Class destroyer USS Fletcher (DD 992) conducts underway operations in support of Operation Iraqi Freedom
navysea
US Navy 030402-N-1810F-005 F-A-18C Hornets are positioned on the bow of USS Kitty Hawk (CV 63) during flight operations
militaryaircraft
US Navy 100213-N-2000D-108 A Marine plays with a Haitian child
operation unified responsegrand-goâve
US Navy divers and Belizean Coast Guard divers practice SCUBA emergency procedures in a pool 140624-N-IP743-311
underwaterwater
US Navy 040611-N-2972R-060 Marine Cpl. Anthony Borja, from Dededo, Guam, removes debris from an M-14 Assault Rifle with his field knife
united states navy images from the atlantic oceanpeople with knives
7601 - 7700 of 54,054 Next page
/ 541